Talk:Enaptin
wow
- Could anyone explain why the word is so long?
- It is not a word per se, but rather a chemical code, as with other similiar substances.
- For an explanation of how the word is made, see Acetylseryltyrosylserylisol...serine#Etymology. -- BRIAN0918 01:47, 30 Mar 2005 (UTC)
Look at the crap!
What was with all this:
MATSRGASRCPRDIANVMQRLQDEQEIVQKRTFTKWINSHLAKRKPPMVVDDLFEDMKDGVKLLALLEVLSGQKL- PCEQGRRMKRIHAVANIGTALKFLEGRKIKLVNINSTDIADGRPSIVLGLMWTIILYFQIEELTSNLPQLQSLSS- SASSVDSIVSSETPSPPSKRKVTTKIQGNAKKALLKWVQYTAGKQTGIEVKDFGKSWRSGVAFHSVIHAIRPELV- DLETVKGRSNRENLEDAFTIAETELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHYPDIHNASTDGQEDDEILP- GFPSFANSVQNFKREDRVIFKEMKVWIEQFERDLTRAQMVESNLQDKYQSFKHFRVQYEMKRKQIEHLIQPLHRD-
(times eight)
? --User:Alex12_3
- Are you an idiot? Did you even try reading the article? -- BRIAN0918 03:22, 30 Mar 2005 (UTC)
- Yeah, I didn't understand it either at first...... then I read the article --Headcase 05:09, 30 Mar 2005 (UTC)
Not the longest
It's been brought to my attention that the largest protein in the body is called titin (appropriately), and has 27,000 amino acids. Expect an article soon. -- BRIAN0918 05:28, 30 Mar 2005 (UTC)
Article be cleaned up please
Article be cleaned up please secfan 08:31, Mar 30, 2005 (UTC)
Removing that long word...
I suggest it be removed... and/or just linked to (or create a new page with this word), as it seems inappropriate in this main article, and people keep removing it not knowing why it was there in the first place. secfan 11:08, Mar 30, 2005 (UTC)