Jump to content

Talk:Enaptin

Page contents not supported in other languages.
From Wikipedia, the free encyclopedia

This is an old revision of this page, as edited by Secfan (talk | contribs) at 11:08, 30 March 2005 (Removing that long word...). The present address (URL) is a permanent link to this revision, which may differ significantly from the current revision.

wow

  • Could anyone explain why the word is so long?
  • It is not a word per se, but rather a chemical code, as with other similiar substances.

Look at the crap!

What was with all this:

MATSRGASRCPRDIANVMQRLQDEQEIVQKRTFTKWINSHLAKRKPPMVVDDLFEDMKDGVKLLALLEVLSGQKL- PCEQGRRMKRIHAVANIGTALKFLEGRKIKLVNINSTDIADGRPSIVLGLMWTIILYFQIEELTSNLPQLQSLSS- SASSVDSIVSSETPSPPSKRKVTTKIQGNAKKALLKWVQYTAGKQTGIEVKDFGKSWRSGVAFHSVIHAIRPELV- DLETVKGRSNRENLEDAFTIAETELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHYPDIHNASTDGQEDDEILP- GFPSFANSVQNFKREDRVIFKEMKVWIEQFERDLTRAQMVESNLQDKYQSFKHFRVQYEMKRKQIEHLIQPLHRD-

(times eight)

? --User:Alex12_3

  • Are you an idiot? Did you even try reading the article? -- BRIAN0918  03:22, 30 Mar 2005 (UTC)
  • Yeah, I didn't understand it either at first...... then I read the article --Headcase 05:09, 30 Mar 2005 (UTC)

Not the longest

It's been brought to my attention that the largest protein in the body is called titin (appropriately), and has 27,000 amino acids. Expect an article soon. -- BRIAN0918  05:28, 30 Mar 2005 (UTC)

  • Alright, it's official: 189,819 letters. -- BRIAN0918  05:43, 30 Mar 2005 (UTC)

Article be cleaned up please

Article be cleaned up please secfan 08:31, Mar 30, 2005 (UTC)

Removing that long word...

I suggest it be removed... and/or just linked to (or create a new page with this word), as it seems inappropriate in this main article, and people keep removing it not knowing why it was there in the first place. secfan 11:08, Mar 30, 2005 (UTC)