Idi na sadržaj

PDGFB

S Wikipedije, slobodne enciklopedije
PDGFB
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

1PDG, 3MJG, 4HQU, 4HQX, 4QCI

Identifikatori
AliasiPDGFB
Vanjski ID-jeviOMIM: 190040 MGI: 97528 HomoloGene: 74303 GeneCards: PDGFB
Lokacija gena (čovjek)
Hromosom 22 (čovjek)
Hrom.Hromosom 22 (čovjek)[1]
Hromosom 22 (čovjek)
Genomska lokacija za PDGFB
Genomska lokacija za PDGFB
Bend22q13.1Početak39,223,359 bp[1]
Kraj39,244,982 bp[1]
Lokacija gena (miš)
Hromosom 15 (miš)
Hrom.Hromosom 15 (miš)[2]
Hromosom 15 (miš)
Genomska lokacija za PDGFB
Genomska lokacija za PDGFB
Bend15 E1|15 37.85 cMPočetak79,995,874 bp[2]
Kraj80,014,977 bp[2]
Obrazac RNK ekspresije




Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija protein homodimerization activity
protein heterodimerization activity
chemoattractant activity
platelet-derived growth factor receptor binding
platelet-derived growth factor binding
superoxide-generating NADPH oxidase activator activity
growth factor activity
vezivanje identičnih proteina
collagen binding
GO:0001948, GO:0016582 vezivanje za proteine
phosphatidylinositol-4,5-bisphosphate 3-kinase activity
Ćelijska komponenta platelet alpha granule lumen
citoplazma
extracellular region
Golđijeva membrana
basolateral plasma membrane
cell surface
endoplasmic reticulum lumen
membrana
GO:0005578 Vanćelijski matriks
Vanćelijsko
Golgi lumen
collagen-containing extracellular matrix
Biološki proces activation of protein kinase B activity
positive regulation of DNA biosynthetic process
positive regulation of chemotaxis
cellular response to growth factor stimulus
positive regulation of protein tyrosine kinase activity
peptidyl-tyrosine phosphorylation
positive regulation of cell division
heart development
positive regulation of glomerular filtration
positive regulation of mitotic nuclear division
positive regulation of MAP kinase activity
positive regulation of metanephric mesenchymal cell migration
positive regulation of hyaluronan biosynthetic process
MAPK cascade
protein phosphorylation
positive regulation of glomerular mesangial cell proliferation
cellular response to mycophenolic acid
positive regulation of fibroblast proliferation
activation of protein kinase activity
multicellular organism development
positive regulation of protein autophosphorylation
positive regulation of reactive oxygen species metabolic process
reactive oxygen species metabolic process
GO:0045996 negative regulation of transcription, DNA-templated
protein kinase C signaling
metanephric glomerular mesangial cell development
negative regulation of phosphatidylinositol biosynthetic process
response to wounding
positive regulation of phosphatidylinositol 3-kinase activity
cell chemotaxis
positive regulation of ERK1 and ERK2 cascade
platelet degranulation
positive regulation of cell population proliferation
positive regulation of DNA replication
GO:1901313 positive regulation of gene expression
embryonic placenta development
paracrine signaling
monocyte chemotaxis
positive regulation of endothelial cell proliferation
positive regulation of phosphatidylinositol 3-kinase signaling
positive regulation of calcium ion import
GO:0060469, GO:0009371 positive regulation of transcription, DNA-templated
GO:0035404 peptidyl-serine phosphorylation
positive regulation of metanephric mesenchymal cell migration by platelet-derived growth factor receptor-beta signaling pathway
positive regulation of blood vessel endothelial cell migration
Hematopoeza
positive regulation of cell migration
positive regulation of peptidyl-tyrosine phosphorylation
extracellular matrix organization
negative regulation of protein binding
positive regulation of MAPK cascade
positive regulation of cyclin-dependent protein serine/threonine kinase activity
negative regulation of platelet activation
phosphatidylinositol phosphate biosynthetic process
positive regulation of vascular associated smooth muscle cell migration
positive chemotaxis
negative regulation of vascular associated smooth muscle cell differentiation
interleukin-18-mediated signaling pathway
positive regulation of pri-miRNA transcription by RNA polymerase II
negative regulation of pri-miRNA transcription by RNA polymerase II
negative regulation of gene expression
positive regulation of smooth muscle cell migration
positive regulation of smooth muscle cell proliferation
positive regulation of vascular associated smooth muscle cell dedifferentiation
platelet-derived growth factor receptor signaling pathway
positive regulation of vascular associated smooth muscle cell proliferation
negative regulation of platelet-derived growth factor receptor-beta signaling pathway
regulation of signaling receptor activity
positive regulation of protein kinase B signaling
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_033016
NM_002608

NM_011057

RefSeq (bjelančevina)

NP_002599
NP_148937

NP_035187

Lokacija (UCSC)Chr 22: 39.22 – 39.24 MbChr 15: 80 – 80.01 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Podjedinica B trombocitno-izvedenog faktora rasta jest protein koji je kod ljudi kodiran genom PDGFB sa hromosoma 22.[5][6]

Aminokiselinska sekvenca

[uredi | uredi izvor]

Dužina polipeptidnog lanca je 241 aminokiselina, a molekulska težina 27.283 Da.[6]

1020304050
MNRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHG
DPGEEDGAELDLNMTRSHSGGELESLARGRRSLGSLTIAEPAMIAECKTR
TEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRP
VQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVTRSPGGSQEQR
AKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETLGA

Funkcija

[uredi | uredi izvor]

Protein kodiran ovim genom je član porodice trombocitnih faktora rasta. Četiri člana ove porodice su mitogeni faktori za ćelije mezenhimskog porijekla i karakteriše ih motiv od osam cisteina. Ovaj genski proizvod može postojati ili kao homodimer (PDGF-BB) ili kao heterodimer sa polipeptidnim faktorom rasta alfa (PDGFA) koji potiče od trombocita (PDGF-AB), gdje su dimeri povezani disulfidnim vezama.

Klinički značaj

[uredi | uredi izvor]

Mutacije ovog gena povezane su sa meningiomom. Recipročne translokacije između hromozoma 22 i 17, na mjestima gdje su locirani geni PDGFB i COL1A1 ili, alternativno, abnormalni mali prekobrojni prstenasti hromosom spajaju ova dva gena u formiraju COL1A-PDGFB fuzijski gen. Ovaj fuzijski gen u velikoj mjeri prekomjerno proizvodi PDGFB i smatra se odgovornim za izazivanje razvoja i/ili progresije tri blisko povezana fibroblastna i miofibroblastna tumora kože: fibroblastom divovskih ćelija, dermatofibrosarcoma protuberans i sarkomski dermatofibrosarkom protuberans.[7]

Za gen PDGFB, identificirane su dvije prerađene varijante transkripta.[8]

Također pogledajte

[uredi | uredi izvor]

Reference

[uredi | uredi izvor]
  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000100311 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000000489 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Ratner L, Josephs SF, Jarrett R, Reitz MS, Wong-Staal F (Sep 1985). "Nucleotide sequence of transforming human c-sis cDNA clones with homology to platelet-derived growth factor". Nucleic Acids Res. 13 (14): 5007–18. doi:10.1093/nar/13.14.5007. PMC 321845. PMID 2991848.
  6. ^ a b Clements JM, Bawden LJ, Bloxidge RE, Catlin G, Cook AL, Craig S, Drummond AH, Edwards RM, Fallon A, Green DR (Jan 1992). "Two PDGF-B chain residues, arginine 27 and isoleucine 30, mediate receptor binding and activation". EMBO J. 10 (13): 4113–20. PMC 453161. PMID 1661670.
  7. ^ Baranov E, Hornick JL (March 2020). "Soft Tissue Special Issue: Fibroblastic and Myofibroblastic Neoplasms of the Head and Neck". Head and Neck Pathology. 14 (1): 43–58. doi:10.1007/s12105-019-01104-3. PMC 7021862. PMID 31950474.
  8. ^ "Entrez Gene: PDGFB platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog)".

Dopunska literatura

[uredi | uredi izvor]
  • Kurup S, Abramsson A, Li JP, Lindahl U, Kjellen L, Betsholtz C, Gerhardt H, Spillmann D (2006). "Heparan sulphate requirement in platelet-derived growth factor B-mediated pericyte recruitment". Biochem. Soc. Trans. 34 (Pt 3): 454–5. doi:10.1042/BST0340454. PMID 16709185.

Vanjski linkovi

[uredi | uredi izvor]